PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m014041
Common NameRCOM_1512990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 100aa    MW: 11490.4 Da    PI: 10.3491
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m014041genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181761448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     WT+eEd +++ +v ++G+g+W++ +++ g++R++k+c++rw +yl
    30147.m014041 17 WTAEEDAKILAYVSKHGTGNWTALPKKAGLRRCGKSCRLRWTNYL 61
                     *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129422.631965IPR017930Myb domain
SMARTSM007171.6E-131363IPR001005SANT/Myb domain
CDDcd001671.21E-111761No hitNo description
SuperFamilySSF466891.16E-221789IPR009057Homeodomain-like
PfamPF002493.0E-161761IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-76588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MVRPPCCDKL NMKRALWTAE EDAKILAYVS KHGTGNWTAL PKKAGLRRCG KSCRLRWTNY  60
LRPHLKHDSF TPQEEELIVR LHAAIGSRLA ITHSYLQFTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-151190482B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0347313e-37KM034731.1 Jatropha curcas clone JcMYB111 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579165.14e-62PREDICTED: transcription factor MYB35
SwissprotQ9LSI74e-48MYB35_ARATH; Transcription factor MYB35
TrEMBLB9R9157e-71B9R915_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0012s07450.12e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-49MYB family protein